PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3B_990298FF5.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 559aa    MW: 59593.8 Da    PI: 6.52
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3B_990298FF5.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.82e-32217273259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkve+s  +++++ei+Y+g+Hnh 
  Traes_3B_990298FF5.1 217 DDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVETSL-EGQITEIVYKGTHNHA 273
                           8****************************************.***************7 PP

2WRKY104.94.3e-33380438159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d ++v++tYeg+Hnh+
  Traes_3B_990298FF5.1 380 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERASHDLRAVITTYEGKHNHD 438
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.1E-28208275IPR003657WRKY domain
SuperFamilySSF1182901.31E-24210275IPR003657WRKY domain
PROSITE profilePS5081122.171211275IPR003657WRKY domain
SMARTSM007741.2E-34216274IPR003657WRKY domain
PfamPF031061.8E-24217272IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.7E-37365440IPR003657WRKY domain
SuperFamilySSF1182902.48E-29372440IPR003657WRKY domain
PROSITE profilePS5081138.411375440IPR003657WRKY domain
SMARTSM007742.1E-38380439IPR003657WRKY domain
PfamPF031062.5E-25381438IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MTTSSSGSVE TSANSRPGSF SFGSASFTEM LGGSAAAGGA SGYKALTPPS LPLSPSLMSP  60
SSFFSMPAGM NLADFLDSPV LLTSSIFPSP TTGAFGSQFN WRPEAPTPSA AEQGGKEEQR  120
QPYSDFSFQT APANSEEAAR ATMTTSLQPP VAVASQGEEA YTGQQQQAWG YGQQQEGMNA  180
SAANPASFSA PALQATSSEM APAGAYRQTH SQRRSSDDGY NWRKYGQKQV KGSENPRSYY  240
KCTFPNCPTK KKVETSLEGQ ITEIVYKGTH NHAKPLNTRR GSGGGAAAAQ VLQIGGDASE  300
NSFGGMVTTP ENSSASFGDD DNGVSSPRSG NVGRNDNDDD EPDSKRRRDS GDGEGINMAG  360
NRTVREPRVV VQTMSDIDIL DDGYRWRKYG QKVVKGNPNP RSYYKCTTVG CPVRKHVERA  420
SHDLRAVITT YEGKHNHDVP AARGSAALYR PAPRAADSTA STGHYLNPQP SAMAYQASAA  480
PNVAGTQQYA PRPDGFGGQN PGSFGFNGNF GFSGAGFDNP TASYMSQHQE QQRQNDAMHA  540
SSAKEEPREE DMFFQNSQY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-36208441878Probable WRKY transcription factor 4
2lex_A2e-36208441878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6654310.0EU665431.1 Triticum aestivum WRKY27 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564512.10.0PREDICTED: probable WRKY transcription factor 33
TrEMBLM7ZVW60.0M7ZVW6_TRIUA; Putative WRKY transcription factor 33
STRINGMLOC_67851.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29923687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-98WRKY DNA-binding protein 33